PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15783A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 469aa    MW: 51262.5 Da    PI: 6.3491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15783AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-17130176148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g WT+eEd +l+++v+q+G + W+ Ia+ ++ gR +kqc++rw+++l
  Oropetium_20150105_15783A 130 KGQWTPEEDRKLAKLVEQFGLRKWSCIAQILP-GRVGKQCRERWHNHL 176
                                799*****************************.*************97 PP

2Myb_DNA-binding52.31.3e-16184224345
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                 W+ eEd  l++a+k+ G++ W+ Ia++++ gRt++++k++w+
  Oropetium_20150105_15783A 184 IWSDEEDMVLIEAHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 224
                                6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.555125180IPR017930Myb domain
SuperFamilySSF466896.74E-31127223IPR009057Homeodomain-like
SMARTSM007174.3E-14129178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-28131184IPR009057Homeodomain-like
PfamPF139219.9E-18133189No hitNo description
CDDcd001672.58E-14133176No hitNo description
SMARTSM007173.0E-16181229IPR001005SANT/Myb domain
PROSITE profilePS5129419.57181231IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-21185229IPR009057Homeodomain-like
CDDcd001672.89E-13185227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MDFSCFQPQA RSCSYMPFDS SYMQPNGLYE LHHVDRAIEG IGEYTPAGSM LPPSANFNDL  60
GHQFYSPRET KRPVVNQVGS YQPLLTPKTE VSHLIDCGLG SYKAYEMNGR FVTRSRKASG  120
NSLKKANIVK GQWTPEEDRK LAKLVEQFGL RKWSCIAQIL PGRVGKQCRE RWHNHLRPNI  180
KKDIWSDEED MVLIEAHKEV GNKWAEIAKR LPGRTENSIK NHWNATKRRQ FARRRSRSSK  240
GPKSGTLLQS YIKSLGITGP SSTTSRNAAA AAPVVAGQPP TTSSPPPPLA AAALFPRANK  300
TTSDGGSEHS RSASSSLMLN AHDGVEIIQS LEELVAPICA EFSVDMFEGL FDGARAEDVF  360
QVCGIDGGGD DDDLDMNCIF SQLDHAGKLK VDHHHHGGID DDMEMTWDDD VLADCIVGLD  420
DSAGGSSSAA SAEMLGEVAQ VKEEMDLVEM MAAIATTQQN RAGAARDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-451282302104C-Myb DNA-Binding Domain
1mse_C1e-451282302104C-Myb DNA-Binding Domain
1gv2_A2e-451282302104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441884.11e-140hypothetical protein SORBIDRAFT_08g004250
TrEMBLC5YSM11e-140C5YSM1_SORBI; Putative uncharacterized protein Sb08g004250
STRINGSb08g004250.11e-140(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-60myb domain protein 98